PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g069190.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 812aa    MW: 90330.8 Da    PI: 6.1592
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g069190.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.99e-24176277199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   
  Sopim11g069190.0.1 176 FCKTLTASDTTTHGGFSVPRRAAEDCfppldyKEQ-RPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL-- 263
                         99****************************86333.45679************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + ++++l+++++r+
  Sopim11g069190.0.1 264 RGEGGNLRLGIRRA 277
                         449999*****996 PP

2Auxin_resp119.52.7e-39302383182
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                         +a+a+s ks+F+v+Y+Pras+++Fvv+++k++ka+++++ vG+Rfkm+f+ +ds+err+sG+v+g+sd+dp+rWpnSkWr+L
  Sopim11g069190.0.1 302 VATALSAKSTFHVFYSPRASHADFVVPYQKYVKAINSRIPVGTRFKMKFDLDDSPERRYSGVVTGISDMDPFRWPNSKWRCL 383
                         6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.31E-43168292IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.8E-40169289IPR015300DNA-binding pseudobarrel domain
CDDcd100175.03E-22174276No hitNo description
PROSITE profilePS5086312.915176278IPR003340B3 DNA binding domain
SMARTSM010191.3E-22176278IPR003340B3 DNA binding domain
PfamPF023621.0E-21176277IPR003340B3 DNA binding domain
PfamPF065078.4E-33303383IPR010525Auxin response factor
SuperFamilySSF542774.12E-11676762No hitNo description
PROSITE profilePS5174521.663683767IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MEIDLNHALV SEVEKNVCCN EECDKGGGGG CVNCSLYTST TSSCSSNVSS SSSLALTSIY  60
KELWHACAGP LTSLPKKGNV VVYFPQGHME EAVSAFPFSP VKIDLPTFGL QPQIFCRVED  120
VQLLANKEND EVYTQLTLLP LPESMAISLE GKEHEDSGTD EEGNGVNPGK SASHMFCKTL  180
TASDTTTHGG FSVPRRAAED CFPPLDYKEQ RPSQELIAKD LHGVEWKFRH IYRGQPRRHL  240
LTTGWSIFVS QKNLVSGDAV LFLRGEGGNL RLGIRRAARP RNGLPESIIK SQYSGPDVLS  300
SVATALSAKS TFHVFYSPRA SHADFVVPYQ KYVKAINSRI PVGTRFKMKF DLDDSPERRY  360
SGVVTGISDM DPFRWPNSKW RCLMVRWDED IMSNHQERVS PWEIDSSVSL PPLSIQSSPR  420
LKKLRTSQQA PSVLDSHFAG GSALLDFEES IRSSKVLQGQ ENLGLISPPY GCDKPVRPLD  480
FELQRVARHN LMPNGVENII VGDFVKTQPP TTYTGFLESN RFPKVLQGQE ICSLRSLTGK  540
GDVNFGAWGK PEFGCNVFGT YQRPRANFYP LASEGARNVF LPYNAMYRAG QDPVVPSYST  600
NFQRENPTLN QNSIQNVVRR EEVGMPKFVN EQRPPEMSKV SIPENHFKNE NDDSFNAQAP  660
CKLFGFSLTK EPSTPSSQSS GKRSCTKVHK QGSLVGRAID LSRLNGYDDL LVELERLFNM  720
EDLLRDPNKG WRILYTDSEN DMMVVGDDPW HEFCEVVSKI HIYTQEEVEK MTIEGISDDT  780
QSCLEEAPAI MDVSKSSSVG QPDSSPTVIR I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1145840518353Auxin response factor 1
4ldw_A1e-1145840518353Auxin response factor 1
4ldv_A1e-1145840518353Auxin response factor 1
4ldy_B1e-1145840518353Auxin response factor 1
4ldy_A1e-1145840518353Auxin response factor 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3402590.0DQ340259.1 Lycopersicon esculentum auxin response factor 4 (ARF4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233771.10.0auxin response factor 4
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLQ2LAI90.0Q2LAI9_SOLLC; Auxin response factor
STRINGSolyc11g069190.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51432234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4